Fast processing
Eligible orders placed before the daily cut-off are prepared for same-day dispatch.
US ORDER SUPPORT • TRACKED DELIVERY OPTIONS • CURRENT CATALOG PRICING

LL-37 For Lab Research is a research catalog compound listed in 10mg quantities. Available options: 10mg. Its catalog profile concerns compound identity, stability and analytical characterisation.
Current price
$197.26
Was $369.37
SKU: PUS-PEPTIDES-LAB-66041
Product information
LL-37 For Lab Research is a research catalog compound listed in 10mg quantities. Available options: 10mg. Its catalog profile concerns compound identity, stability and analytical characterisation.
LL-37 For Lab Research. Sequence: [LL-37, 37 aa] — 37 residues, net charge approximately +6. Source-listed purity: >99% (HPLC verified). Form: Lyophilized powder. Solubility: Sterile water, bacteriostatic water, or suitable laboratory buffer. Product identity and supplied quantity should be checked against the item label. Supplier testing, shipping promises and treatment claims are not guarantees made by Peptides-US.
The listing is organised to make format, current price, availability, and catalogue information easy to verify before an order is placed.
What is included
Research profile
The catalogue profile for LL-37 For Lab Research centres on compound identity, stability and analytical characterisation.
Reading the literature
When reading about LL-37 For Lab Research, check the exact preparation, study population and measured outcome. A proposed mechanism or laboratory result is not a clinical benefit claim for this catalogue item. Educational references do not establish that this product is equivalent to an approved medicine.
Technical data
Product care
The source listing records storage temperatures of 20°C for the applicable material or prepared format. Confirm which condition applies using the supplied label and a validated laboratory protocol; do not treat different conditions as interchangeable.
Order information
Eligible orders placed before the daily cut-off are prepared for same-day dispatch.
Tracking details are provided when supported by the selected delivery service.
Orders are packed to support product integrity throughout delivery.
Common questions
Need more information?
Explore more
Stock: In Stock
Alluvi Retatrutide 20mg Pen ×2 Bundle is supplied in a pre-calibrated device format for consiste...
from
$264.77
Stock: In Stock
Alluvi Retatrutide 40mg Research Pen is supplied in a pre-calibrated device format for consisten...
from
$251.53
Stock: In Stock
Retatrutide 5mg Research Peptide is a laboratory catalog compound available as Lyophilized Powde...
from
$99.29 – $119.15
Stock: In Stock
Alluvi Tirzepatide 40mg is supplied in a pre-calibrated device format for consistent handling an...
from
$158.85